Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Frog virus 3 (isolate Goorha) (FV-3)
Uniprot NO.:Q6GZX1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNAKYDTDQGVGRMLFLGTIGLAVVVGGLMAYGYYYDGKTPSSGTSFHTASPSFSSRYRY
Protein Names:Recommended name: Uncharacterized protein 004R
Gene Names:ORF Names:FV3-004R
Expression Region:1-60
Sequence Info:full length protein