Recombinant Frog virus 3  Uncharacterized protein 004R(FV3-004R)

Recombinant Frog virus 3 Uncharacterized protein 004R(FV3-004R)

CSB-CF760698FDG
Regular price
$1,043.00 USD
Sale price
$1,043.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Frog virus 3 (isolate Goorha) (FV-3)

Uniprot NO.:Q6GZX1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNAKYDTDQGVGRMLFLGTIGLAVVVGGLMAYGYYYDGKTPSSGTSFHTASPSFSSRYRY

Protein Names:Recommended name: Uncharacterized protein 004R

Gene Names:ORF Names:FV3-004R

Expression Region:1-60

Sequence Info:full length protein

Your list is ready to share