Skip to product information
1 of 1

Gene Bio Systems

Recombinant Flavobacterium johnsoniae Large-conductance mechanosensitive channel(mscL)

Recombinant Flavobacterium johnsoniae Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF401084FDT

Regular price $1,712.00 USD
Regular price Sale price $1,712.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) (Cytophaga johnsonae)

Uniprot NO.:A5FKC3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGFFSEFKEFAMKGNVVDLAVGVIIGAAFGKIVSSFIEDVITPLLLKPALDAANLSTIEQ LTAFGGVKYGLFLSAVINFIIVAFVLFLIIKAMNHAKKKDVAPPPPPAGPTQEELLTQIR DLLKNK

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:Fjoh_1319

Expression Region:1-126

Sequence Info:full length protein

View full details