Gene Bio Systems
Recombinant Fagopyrum esculentum subsp. ancestrale ATP synthase subunit b, chloroplastic(atpF)
Recombinant Fagopyrum esculentum subsp. ancestrale ATP synthase subunit b, chloroplastic(atpF)
SKU:CSB-CF457036FEC
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Fagopyrum esculentum subsp. ancestrale (Wild buckwheat)
Uniprot NO.:B2XWN5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKNVTDSFVSLGHWRSAGSFGFNTDIFATNPINLSVVIGVLIFFGKGVFSDLLDNRKLRI VNTIRNSEELCGRAVEQLEKARARLRKVEMEADQFRMNGYSEIERDKLNLINSIYKTLEQ LENYKNETIHFEQQRVINQVRLRVFQQALQGALGTLNSCLSNELHLRTINANIGMFGAMK EITD
Protein Names:Recommended name: ATP synthase subunit b, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I
Gene Names:Name:atpF
Expression Region:1-184
Sequence Info:full length protein
