Recombinant Exiguobacterium sibiricum  UPF0295 protein Exig_0660 (Exig_0660)

Recombinant Exiguobacterium sibiricum UPF0295 protein Exig_0660 (Exig_0660)

CSB-CF452113EPT
Regular price
$1,100.00 USD
Sale price
$1,100.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)

Uniprot NO.:B1YK60

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKQRKNKINRARNLAMFLVFGGMLVMYGGLLLKQFEIIMVILMLVGFVMVLASTALYFL IGLTSTKAAVVTCPNCGKETKVLGRVDLCMHCDEPLTMDRNLEGKEFDEKYNKHSKRAPR

Protein Names:Recommended name: UPF0295 protein Exig_0660

Gene Names:Ordered Locus Names:Exig_0660

Expression Region:1-120

Sequence Info:full length protein

Your list is ready to share