Skip to product information
1 of 1

Gene Bio Systems

Recombinant Exiguobacterium sibiricum Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

Recombinant Exiguobacterium sibiricum Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

SKU:CSB-CF452102EPT

Regular price $1,880.00 USD
Regular price Sale price $1,880.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)

Uniprot NO.:B1YH82

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIVGQHIPGTSYLHRSSAVAKIIFAFCFIPLVFLANNAATNIFLLLFTFFALASSKLPIR YVLKGLRPILFLIIFTFIIQLLFTREGAVLFEFGWFKIYEEGLRLAIIVSLRFFYLVSIT TLVTLTTSPIELTDAIELLLKPFKVVRVPTHEIALMLSISLRFLPTLAEETEKIMKAQQA RGVDLSAGPIKERLRAIIPLLIPLFISAFKRAEDLATAMEARGYRGGEGRTRLRESKWTT RDTGLILLLVALGLLLVYLRGGF

Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein EcfT Short name= ECF transporter T component EcfT

Gene Names:Name:ecfT Ordered Locus Names:Exig_0127

Expression Region:1-263

Sequence Info:full length protein

View full details