Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Thiosulfate sulfurtransferase GlpE(glpE)

Recombinant Escherichia coli Thiosulfate sulfurtransferase GlpE(glpE)

SKU:CSB-EP533026ENP

Regular price $1,243.00 USD
Regular price Sale price $1,243.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: B1IP41

Gene Names: glpE

Organism: Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

AA Sequence: MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEVWQRQFPAEVAYGA

Expression Region: 1-108aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 16.1 kDa

Alternative Name(s):

Relevance: Catalyzes, although with low efficiency, the sulfur transfer reaction from thiosulfate to cyanide.

Reference: "Complete sequence of Escherichia coli C str. ATCC 8739."Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H., Bruce D., Goodwin L., Pitluck S., Kiss H., Brettin T., Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L. Richardson P.Submitted (FEB-2008).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details