Gene Bio Systems
Recombinant Escherichia coli Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD)
Recombinant Escherichia coli Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD)
SKU:CSB-CF364747ENV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P0AC44
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
Protein Names:Recommended name: Succinate dehydrogenase hydrophobic membrane anchor subunit
Gene Names:Name:sdhD Ordered Locus Names:b0722, JW0712
Expression Region:1-115
Sequence Info:full length protein
