Gene Bio Systems
Recombinant Escherichia coli Putative uncharacterized protein b1142 (b1142, JW1128)
Recombinant Escherichia coli Putative uncharacterized protein b1142 (b1142, JW1128)
SKU:CSB-CF304315ENV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P75971
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVNAAQRTRVKVEADNRPSVDTHPPGVQPSPGTGGTRHHNFMLCVVLAVPVFSLVLSGTA LFTKQRRVSPDDGLITRPILIAVATGALLCFVEKLTDRAGSIC
Protein Names:Recommended name: Putative uncharacterized protein b1142
Gene Names:Ordered Locus Names:b1142, JW1128
Expression Region:1-103
Sequence Info:full length protein
