Gene Bio Systems
Recombinant Escherichia coli Protein elaB(elaB)
Recombinant Escherichia coli Protein elaB(elaB)
SKU:CSB-CF365149ENV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P0AEH5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNQFGDTRIDDDLTLLSETLEEVLRSSGDPADQKYVELKARAEKALDDVKKRVSQASDS YYYRAKQAVYRADDYVHEKPWQGIGVGAAVGLVLGLLLARR
Protein Names:Recommended name: Protein elaB
Gene Names:Name:elaB Synonyms:yfbD Ordered Locus Names:b2266, JW2261
Expression Region:1-101
Sequence Info:full length protein
