Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli O9:H4 Cysteine-O-acetylserine efflux protein(eamB)

Recombinant Escherichia coli O9:H4 Cysteine-O-acetylserine efflux protein(eamB)

SKU:CSB-CF424151EJF

Regular price $1,871.00 USD
Regular price Sale price $1,871.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O9:H4 (strain HS)

Uniprot NO.:A8A390

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTPTLLSAFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGI SFSLAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKI ILYGVTALSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNI VLALLLVYCAVRIFY

Protein Names:Recommended name: Cysteine/O-acetylserine efflux protein

Gene Names:Name:eamB Ordered Locus Names:EcHS_A2735

Expression Region:1-195

Sequence Info:full length protein

View full details