Recombinant Escherichia coli O81  Universal stress protein B(uspB)

Recombinant Escherichia coli O81 Universal stress protein B(uspB)

CSB-CF482777EOP
Regular price
$1,084.00 USD
Sale price
$1,084.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O81 (strain ED1a)

Uniprot NO.:B7N1S8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH

Protein Names:Recommended name: Universal stress protein B

Gene Names:Name:uspB Ordered Locus Names:ECED1_4163

Expression Region:1-111

Sequence Info:full length protein