Recombinant Escherichia coli O157:H7 Major curlin subunit (csgA), partial

SKU: Q93U24

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q93U24

Gene Names: csgA

Alternative Name(s):

Abbreviation: Recombinant E.coli O157: H7 csgA protein, partial

Organism: Escherichia coli O157: H7

Source: E.coli

Expression Region: 64-113aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-SUMO-tagged

Target Protein Sequence: ARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKDSH

MW: 18.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin.

Reference: "Mutations in the csgD promoter associated with variations in curli expression in certain strains of Escherichia coli O157: H7." Uhlich G.A., Keen J.E., Elder R.O. Appl. Environ. Microbiol. 67: 2367-2370(2001)

Function: