Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli O127:H6 Lipoprotein signal peptidase(lspA)

Recombinant Escherichia coli O127:H6 Lipoprotein signal peptidase(lspA)

SKU:CSB-CF483014EOB

Regular price $1,759.00 USD
Regular price Sale price $1,759.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O127:H6 (strain E2348/69 / EPEC)

Uniprot NO.:B7UI72

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQSICSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVPLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKKQ

Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II

Gene Names:Name:lspA Ordered Locus Names:E2348C_0027

Expression Region:1-164

Sequence Info:full length protein

View full details