Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli NADH-quinone oxidoreductase subunit K(nuoK)

Recombinant Escherichia coli NADH-quinone oxidoreductase subunit K(nuoK)

SKU:CSB-CF484100ENM

Regular price $1,507.00 USD
Regular price Sale price $1,507.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain 55989 / EAEC)

Uniprot NO.:B7LAU1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K

Gene Names:Name:nuoK Ordered Locus Names:EC55989_2523

Expression Region:1-100

Sequence Info:full length protein

View full details