Recombinant Escherichia coli  Inner membrane protein ygiZ(ygiZ)

Recombinant Escherichia coli Inner membrane protein ygiZ(ygiZ)

CSB-CF670506ENV
Regular price
$1,083.00 USD
Sale price
$1,083.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:Q46867

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKQKIKTIFEALLYIMLTYWLIDSFFAFNKYDWMLESGGNICSIPSVSGEDRILQAMIA AFFLLTPLIILILRKLFMREMFEFWVYVFSLGICLVCGWWLFWGRFIFCY

Protein Names:Recommended name: Inner membrane protein ygiZ

Gene Names:Name:ygiZ Ordered Locus Names:b3027, JW2995

Expression Region:1-110

Sequence Info:full length protein