
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: B7LFE3
Gene Names: ghrA
Organism: Escherichia coli (strain 55989 / EAEC)
AA Sequence: MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY
Expression Region: 1-312aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 51.4 kDa
Alternative Name(s): 2-ketoacid reductase
Relevance: Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively.
Reference: "Organised genome dynamics in the Escherichia coli species results in highly diverse adaptive paths." Touchon M., Hoede C., Tenaillon O., Barbe V., Baeriswyl S., Bidet P., Bingen E., Bonacorsi S., Bouchier C., Bouvet O., Calteau A., Chiapello H., Clermont O., Cruveiller S., Danchin A., Diard M., Dossat C., Karoui M.E.Denamur E. PLoS Genet. 5:E1000344-E1000344(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Escherichia coli Glyoxylate-hydroxypyruvate reductase A(ghrA)
- Regular price
- $1,087.00 USD
- Sale price
- $1,087.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Glyoxylate-hydroxypyruvate reductase A(ghrA)
- Regular price
- $1,139.00 USD
- Sale price
- $1,139.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Agmatinase(speB)
- Regular price
- $1,139.00 USD
- Sale price
- $1,139.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Agmatinase(speB)
- Regular price
- $1,139.00 USD
- Sale price
- $1,139.00 USD
- Regular price
-
- Unit price
- per
Sold out