Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Glutaminase 1(glsA1)

Recombinant Escherichia coli Glutaminase 1(glsA1)

SKU:CSB-EP302868ENV

Regular price $1,271.00 USD
Regular price Sale price $1,271.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P77454

Gene Names: glsA1

Organism: Escherichia coli (strain K12)

AA Sequence: MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVFKG

Expression Region: 1-310aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

MW: 62.9 kDa

Alternative Name(s):

Relevance:

Reference: Functional and structural characterization of four glutaminases from Escherichia coli and Bacillus subtilis.Brown G., Singer A., Proudfoot M., Skarina T., Kim Y., Chang C., Dementieva I., Kuznetsova E., Gonzalez C.F., Joachimiak A., Savchenko A., Yakunin A.F.Biochemistry 47:5724-5735(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details