Skip to product information
1 of 1

GeneBio Systems

Recombinant Escherichia coli Glutamate/aspartate import permease protein GltK (gltK), partial

Recombinant Escherichia coli Glutamate/aspartate import permease protein GltK (gltK), partial

SKU:P0AER5

Regular price $1,033.00 USD
Regular price Sale price $1,033.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Signal Transduction

Uniprot ID: P0AER5

Gene Names: gltK

Alternative Name(s):

Abbreviation: Recombinant E.coli gltK protein, partial

Organism: Escherichia coli (strain K12)

Source: E.coli

Expression Region: 113-154aa

Protein Length: Partial

Tag Info: N-terminal GST-tagged

Target Protein Sequence: SEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAM

MW: 31.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Part of the ABC transporter complex GltIJKL involved in glutamate and aspartate uptake. Probably responsible for the translocation of the substrate across the membrane. ; (Microbial infection) Probably transports the toxic C-terminal region of CdiA from P.luminescens strain TTO1 across the inner membrane to the cytoplasm, where CdiA has a toxic effect. Toxin transport is strain-specific, mutations in this gene do not confer resistance to several other tested CdiA toxins.

Reference:

Function:

View full details