Gene Bio Systems
Recombinant Escherichia coli DNA repair protein recO(recO)
Recombinant Escherichia coli DNA repair protein recO(recO)
SKU:CSB-EP364006ENV
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P0A7H3
Gene Names: recO
Organism: Escherichia coli (strain K12)
AA Sequence: MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE
Expression Region: 1-242aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 43.4 kDa
Alternative Name(s): Recombination protein O
Relevance: Involved in DNA repair and RecF pathway recombination.
Reference: Molecular analysis of the Escherichia coli recO gene.Morrison P.T., Lovett S.T., Gilson L.E., Kolodner R.J. Bacteriol. 171:3641-3649(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
