Skip to product information
1 of 1

Gene Bio Systems

Recombinant Equine herpesvirus 1 Protein UL20 homolog (41)

Recombinant Equine herpesvirus 1 Protein UL20 homolog (41)

SKU:CSB-CF338976EFJ

Regular price $1,896.00 USD
Regular price Sale price $1,896.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Equine herpesvirus 1 (strain Ab4p) (EHV-1) (Equine abortion virus)

Uniprot NO.:P28971

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPQVLMGNTRLHAPLEDGIPLIENDENSSQNEVDLYDYVSMSSYGGDNDFLISSAGGNIT PENRPSFSAHVVLFAISALVIKPVCCFIFLNHYVITGSYDFAVAGGVCTVLYYMRLALTA WFMFRNIQSDMLPLNVWQQFVIGCMALGRTVAFMVVSYTTLFIRSELFFSMLAPNAGREY ITPIIAHKLMPLISVRSAVCLVIISTAVYAADAICDTIGFTLPRMWMCILMRSSSVKRS

Protein Names:Recommended name: Protein UL20 homolog

Gene Names:Ordered Locus Names:41

Expression Region:1-239

Sequence Info:full length protein

View full details