Skip to product information
1 of 1

Gene Bio Systems

Recombinant Enterococcus faecalis UPF0316 protein EF_1609(EF_1609)

Recombinant Enterococcus faecalis UPF0316 protein EF_1609(EF_1609)

SKU:CSB-CF800784ELW

Regular price $1,781.00 USD
Regular price Sale price $1,781.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Enterococcus faecalis (strain ATCC 700802 / V583)

Uniprot NO.:Q834N5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVVDLKMLAMIFIINFAYITLNTIRFMLTMKGYRVIAPLVSMAEITIYVLGLSMVLNRLD NPLNLLVYALGYAVGISVGIKIEDYLALGYIMVSVILPSTTEQFHLPETLREHGYGVTQS VAYGREGERMVLEILSPRKNERTLYKLINQLEPRAFIISYEPKFISGGFWTKKVRKRNDA ISH

Protein Names:Recommended name: UPF0316 protein EF_1609

Gene Names:Ordered Locus Names:EF_1609

Expression Region:1-183

Sequence Info:full length protein

View full details