Skip to product information
1 of 1

Gene Bio Systems

Recombinant Enterobacteria phage T6 Beta-glucosyl-HMC-alpha-glucosyl-transferase

Recombinant Enterobacteria phage T6 Beta-glucosyl-HMC-alpha-glucosyl-transferase

SKU:CSB-EP313316EEA

Regular price $1,082.00 USD
Regular price Sale price $1,082.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q06718

Gene Names: N/A

Organism: Enterobacteria phage T6 (Bacteriophage T6)

AA Sequence: MIQFVIPSYQRVGAVSALDMFPTDYEPHIVVREHEEKAYNDAYGSRAKIITIPDGVNGIAGTRKAITDMYAGQRIWMIDDDTTIRMSSMRKRDDRRCVDKVNQLTHEQFYELIQYVEDAMDCGYYHGHARLPIFKITSSWGNYRENSYGFTNTWYDLGKLTTEQIGYGKIDLCEDMYAFLNLINQGYPHLALFKYLVVSGKAQAPGGCSSIRSNSKHNRALEQINREFPEQARWKTSNIEKRKSLGEEDEPLKVLRMCVSRKEKSEAFHKFNAIHPIAVD

Expression Region: 1-280aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 36.3 kDa

Alternative Name(s):

Relevance: Transfers a gentiobiosyl-group on a hydroxymethylcytosine residue in DNA. Is involved in a DNA modification process to protects the phage genome against its own nucleases and the host restriction endonuclease system.

Reference: "Cloning and sequencing of the genes of beta-glucosyl-HMC-alpha-glucosyl-transferases of bacteriophages T2 and T6." Winkler M., Rueger W. Nucleic Acids Res. 21:1500-1500(1993)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details