Recombinant Enterobacteria phage T4 Small outer capsid protein (soc)

SKU: P03715

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P03715

Gene Names: soc

Alternative Name(s): Soc

Abbreviation: Recombinant Enterobacteria phage T4 Small outer capsid protein

Organism: Enterobacteria phage T4 (Bacteriophage T4)

Source: E.coli

Expression Region: 1-80aa

Protein Length: Full Length

Tag Info: N-terminal 6xHis-SUMO-tagged

Target Protein Sequence: MASTRGYVNIKTFEQKLDGNKKIEGKEISVAFPLYSDVHKISGAHYQTFPSEKAAYSTVYEENQRTEWIAANEDLWKVTG

MW: 22.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Capsid decoration protein which helps to stabilize the capsid against extremes of pH and temperature. Once maturation and expansion of the capsid has occured, trimers of soc attach the interfaces between the hexamer of the major capsid protein. Acts as a 'glue' between neighboring hexameric capsomers. Dispensable for the head morphogenesis and phage infection.

Reference:

Function: