Skip to product information
1 of 1

Gene Bio Systems

Recombinant Enterobacteria phage P22 Superinfection exclusion protein A(sieA)

Recombinant Enterobacteria phage P22 Superinfection exclusion protein A(sieA)

SKU:CSB-CF657115EDG

Regular price $1,759.00 USD
Regular price Sale price $1,759.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Enterobacteria phage P22 (Bacteriophage P22)

Uniprot NO.:Q38674

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDSMSYAVLVAATLFLGIGLQIAWLFFSNFIKRKRLESRISEVSIAIGKNAKNPENEAY VLNYLKEKFSPERFENRITDALGLIISVIHIPLSLLITVWYFAMIAGRIFGFMNIEPVVL WVPMILQLLLSIAIFIFSVFIKIVFGRYPGEANGFNKEFIKTIK

Protein Names:Recommended name: Superinfection exclusion protein A

Gene Names:Name:sieA

Expression Region:1-164

Sequence Info:full length protein

View full details