Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterobacteria phage IKe (Bacteriophage IKe)
Uniprot NO.:P03674
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPALLGIPALIRFIMGLVPIAIGYFAKFLGMIITRNGLMASALIGAILSVVSFSIQLLGD ALSSSMGGISADFGNLMSSVLPDGTTTCITVIITTRIAVFVFDIKDRLLGIANKVI
Protein Names:Recommended name: Head virion protein G6P Alternative name(s): Coat protein D G6P
Gene Names:Name:VI
Expression Region:1-116
Sequence Info:full length protein