Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B(stxB)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B(stxB)

CSB-EP300809EKZa0
Regular price
$972.00 USD
Sale price
$972.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P69179

Gene Names: stxB

Organism: Enterobacteria phage H19B (Bacteriophage H19B)

AA Sequence: TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Expression Region: 21-89aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 11.7 kDa

Alternative Name(s): Verocytotoxin 1 subunit B

Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Reference: "Nucleotide sequence and promoter mapping of the Escherichia coli Shiga-like toxin operon of bacteriophage H-19B." de Grandis S., Ginsberg J., Toone M., Climie S., Friesen J., Brunton J.L. J. Bacteriol. 169:4313-4319(1987)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B(stxB)
    Regular price
    $1,253.00 USD
    Sale price
    $1,253.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B(stxB)
    Regular price
    $1,142.00 USD
    Sale price
    $1,142.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B(stxB2)
    Regular price
    $1,142.00 USD
    Sale price
    $1,142.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B(stxB2)
    Regular price
    $1,253.00 USD
    Sale price
    $1,253.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share