Gene Bio Systems
Recombinant Enterobacter sp. UPF0114 protein Ent638_3411 (Ent638_3411)
Recombinant Enterobacter sp. UPF0114 protein Ent638_3411 (Ent638_3411)
SKU:CSB-CF395024EIZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterobacter sp. (strain 638)
Uniprot NO.:A4WEE1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MERFFENAMYASRWLLAPVYFGLSLALVALSIKFFQEIFHVLPNIFSVAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDIAEHKEKLSWLGKMDASSLKNKVAASIVAISSIH LLRVFMDAKNIPDNKLMWYVIIHLTFVLSAFVMGYLDKINRSGKY
Protein Names:Recommended name: UPF0114 protein Ent638_3411
Gene Names:Ordered Locus Names:Ent638_3411
Expression Region:1-165
Sequence Info:full length protein
