Skip to product information
1 of 1

Gene Bio Systems

Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU04_1080(ECU04_1080)

Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU04_1080(ECU04_1080)

SKU:CSB-CF823415EKH

Regular price $1,542.00 USD
Regular price Sale price $1,542.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)

Uniprot NO.:Q8SVT0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAESVASSESLPQMKPEEPESKKSPSREAIPKDMPVVNVRDIMMYVENMEGMENKKLIPY VVYLDEQFKEIVQKRRKDARVVFIFMIAIMSMLVIGLVVCGVKLLGYLMEQK

Protein Names:Recommended name: Uncharacterized membrane protein ECU04_1080

Gene Names:Ordered Locus Names:ECU04_1080

Expression Region:1-112

Sequence Info:full length protein

View full details