Skip to product information
1 of 1

Gene Bio Systems

Recombinant Emerin homolog 1(emr-1)

Recombinant Emerin homolog 1(emr-1)

SKU:CSB-CF519041CXY

Regular price $1,761.00 USD
Regular price Sale price $1,761.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:O01971

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDVSQLTDAELRDSLKSHGVSVGPIVATTRKLYEKKLIKLSDGSINNQSNLNDSQFNEDS LIISSSPKKSPPQRVFQNVSAATAAATTSPESDSDDCEESMRYLTEEEMAADRASARQAQ SNKGGFLGSTITFTILFVFIAVFAYFLIENAEQLKLVAETNPEDTI

Protein Names:Recommended name: Emerin homolog 1 Alternative name(s): Ce-emerin

Gene Names:Name:emr-1 ORF Names:M01D7.6

Expression Region:1-166

Sequence Info:full length protein

View full details