Skip to product information
1 of 1

Gene Bio Systems

Recombinant Emericella nidulans Protein get1(get1)

Recombinant Emericella nidulans Protein get1(get1)

SKU:CSB-CF701668EKF

Regular price $1,799.00 USD
Regular price Sale price $1,799.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)

Uniprot NO.:Q5B538

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISLIWTIFILHIAIFLVNTIGAATIDNLLWLLYLKLPTSLYQTAQEQTKLKREVVQLKR DMNNTSSQDEFAKWAKLRRRHDKALSEYEALNQKLSSQKGSFDWFVKIARWLSTTGLKIF IQFRYSKTPVFELPGGWLPYPVEWVLAFPRAPQGSVSVQVWNSVCATAVTVIAEIITGLA LQVKGSAQAVPATAKKA

Protein Names:Recommended name: Protein get1 Alternative name(s): Guided entry of tail-anchored proteins 1

Gene Names:Name:get1 ORF Names:AN4342

Expression Region:1-197

Sequence Info:full length protein

View full details