Gene Bio Systems
Recombinant Elephantid herpesvirus 1 Glycoprotein N
Recombinant Elephantid herpesvirus 1 Glycoprotein N
SKU:CSB-CF619285EAAN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) (EIHV-1) (Elephant endotheliotropic herpesvirus)
Uniprot NO.:Q18LF1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MARINSNSGTAVLSRGAAVPAARRPASGTSASKISKLSSTGPPNAPWSKSLTIFKTFISV YLGQAACLAASSRISSRCIVCIRSTLFLTLFALNVAQEFVFGATPAPTVKTDLNIRDFSK SSCSALKYRIYVSSFVSVLNIILYVLLFLASVVYIRYLCHQSITTETVKDY
Protein Names:Recommended name: Glycoprotein N Short name= gN
Gene Names:
Expression Region:1-171
Sequence Info:full length protein
