Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila yakuba Vacuolar ATPase assembly integral membrane protein VMA21 (GE19686)

Recombinant Drosophila yakuba Vacuolar ATPase assembly integral membrane protein VMA21 (GE19686)

SKU:CSB-CF025866DMR

Regular price $1,687.00 USD
Regular price Sale price $1,687.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila yakuba (Fruit fly)

Uniprot NO.:B4PET6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTKNKKAAGGNGGAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQ FLDISEVKVNIASAVGAVVALHVALGLYIYRAYFGAPGSKASKTD

Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21

Gene Names:ORF Names:GE19686

Expression Region:1-105

Sequence Info:full length protein

View full details