
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila subobscura (Fruit fly)
Uniprot NO.:P51940
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSIILIASLILTIVTIVMFLASILSKKALIDREKSSPFECGFDPKSSSRLPFSLRFFLI TIIFLIFDVEIALILPMIIIMKFSNIMIWTTTSIIFILILLIGLYHEWNQGMLNWSN
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 3 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 3
Gene Names:Name:mt:ND3 Synonyms:ND3
Expression Region:1-117
Sequence Info:full length protein
You may also like
-
Recombinant Drosophila yakuba NADH-ubiquinone oxidoreductase chain 3(mt:ND3)
- Regular price
- $1,558.00 USD
- Sale price
- $1,558.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Drosophila melanogaster NADH-ubiquinone oxidoreductase chain 3(mt:ND3)
- Regular price
- $1,558.00 USD
- Sale price
- $1,558.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Drosophila subsilvestris NADH-ubiquinone oxidoreductase chain 1(mt:ND1)
- Regular price
- $1,610.00 USD
- Sale price
- $1,610.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Drosophila obscura NADH-ubiquinone oxidoreductase chain 1(mt:ND1)
- Regular price
- $1,610.00 USD
- Sale price
- $1,610.00 USD
- Regular price
-
- Unit price
- per
Sold out