Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila simulans Calcium channel flower(flower)

Recombinant Drosophila simulans Calcium channel flower(flower)

SKU:CSB-CF455800DMJ

Regular price $1,796.00 USD
Regular price Sale price $1,796.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila simulans (Fruit fly)

Uniprot NO.:B4QLP9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFAEKITGLLARPNQQDPIGPEQPWYLKYGSRWLGIVAAFFAILFGLWNVFSIITLSVS CLVAGIIQMVAGFVVMLLEAPCCFVCFEQVNVIADKVDSKPLYFRAGLYIAMAIPPIILC FGLASLFGSGLIFGTGVVYGMMALGKKASAEDMRAAAQQTFGGNTPAQTNDRAGIVNNAQ PFSFTGAVGTDSNV

Protein Names:Recommended name: Calcium channel flower

Gene Names:Name:flower ORF Names:GD12536

Expression Region:1-194

Sequence Info:full length protein

View full details