Gene Bio Systems
Recombinant Drosophila melanogaster UPF0640 protein CG32736(CG32736)
Recombinant Drosophila melanogaster UPF0640 protein CG32736(CG32736)
SKU:CSB-CF896189DLU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila melanogaster (Fruit fly)
Uniprot NO.:Q9W3T5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSPYSGSVRRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETNFYRTFKRRQA KNYVEEQQHLQARAANNTN
Protein Names:Recommended name: UPF0640 protein CG32736
Gene Names:ORF Names:CG32736
Expression Region:1-79
Sequence Info:full length protein
