Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Transmembrane protein 70 homolog, mitochondrial(CG7506)

Recombinant Drosophila melanogaster Transmembrane protein 70 homolog, mitochondrial(CG7506)

SKU:CSB-CF856836DLU

Regular price $1,769.00 USD
Regular price Sale price $1,769.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q95SS8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SDDALQRIYYGTLAPRMKMVKFFSLSTSLAGLAAQPILLEQGMKIGGTGMAVFLCTVGGF FTFVTPLLLHFITKKYVTELHYNPLTEEYTATTISLLLQKIKTTFRPNDVVVPEVPGMFT SFLVNKRPLFVDPALFDDPEHYVKIMGYDKPIDFKLDLTPNPEKSKTSEEKQ

Protein Names:Recommended name: Transmembrane protein 70 homolog, mitochondrial

Gene Names:ORF Names:CG7506

Expression Region:65-236

Sequence Info:full length protein

View full details