Gene Bio Systems
Recombinant Drosophila melanogaster Nuclear envelope phosphatase-regulatory subunit 1 homolog(CG8009)
Recombinant Drosophila melanogaster Nuclear envelope phosphatase-regulatory subunit 1 homolog(CG8009)
SKU:CSB-CF840533DLU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila melanogaster (Fruit fly)
Uniprot NO.:Q8T0B1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEPSACEDLKAFERRLTEVVSSYRPSTFRWRKLLAVVLSAMSMCTAISAWYWLRDPRTTV VPLTESLWIHPVFTVATLTLVVLFILGIQKLVIAPQIITSRTRMVLGDFNMSCDDTGKLI LKPRQSNNNST
Protein Names:Recommended name: Nuclear envelope phosphatase-regulatory subunit 1 homolog Alternative name(s): Transmembrane protein 188
Gene Names:ORF Names:CG8009
Expression Region:1-131
Sequence Info:full length protein
