Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster ER lumen protein retaining receptor(KdelR)

Recombinant Drosophila melanogaster ER lumen protein retaining receptor(KdelR)

SKU:CSB-CF527995DLU

Regular price $1,819.00 USD
Regular price Sale price $1,819.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:O76767

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIFRFAGDLSHVFAIIILLLKIWKTRSCAGISGKSQILFAVVYLTRYLDLFTTYVSLYN SVMKVLFLATSGATVYLMYVKFKATYDHNHDSFRIEFLLVPCALLSLVINHEFTVMEVLW TFSIYLESVAILPQLFLVSRTGEAESITSHYLFALGSYRALYLLNWVYRYMVESHYDLIA IFAGVVQTVLYCDFFYLYITKVLKGKKLQLPA

Protein Names:Recommended name: ER lumen protein retaining receptor

Gene Names:Name:KdelR Synonyms:Erd2 ORF Names:CG5183

Expression Region:1-212

Sequence Info:full length protein

View full details