Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dog V-type proton ATPase subunit e 1(ATP6V0E1)

Recombinant Dog V-type proton ATPase subunit e 1(ATP6V0E1)

SKU:CSB-CF858984DO

Regular price $1,503.00 USD
Regular price Sale price $1,503.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Canis familiaris (Dog) (Canis lupus familiaris)

Uniprot NO.:Q9BDP4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AYHGLTVPLIVMSVFWGFVGFCVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLN PLFGPQLKNETIWYLKYHWP

Protein Names:Recommended name: V-type proton ATPase subunit e 1 Short name= V-ATPase subunit e 1 Alternative name(s): V-ATPase 9.2 kDa membrane accessory protein V-ATPase M9.2 subunit Vacuolar proton pump subunit e 1

Gene Names:Name:ATP6V0E1 Synonyms:ATP6H, ATP6V0E

Expression Region:2-81

Sequence Info:full length protein

View full details