Gene Bio Systems
Recombinant Dog Protein transport protein Sec61 subunit gamma(SEC61G)
Recombinant Dog Protein transport protein Sec61 subunit gamma(SEC61G)
SKU:CSB-CF020959DO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Canis familiaris (Dog) (Canis lupus familiaris)
Uniprot NO.:P60058
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG
Protein Names:Recommended name: Protein transport protein Sec61 subunit gamma
Gene Names:Name:SEC61G
Expression Region:1-68
Sequence Info:full length protein
