Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dog Glycoprotein hormones alpha chain(CGA)

Recombinant Dog Glycoprotein hormones alpha chain(CGA)

SKU:CSB-EP895474DO

Regular price $982.00 USD
Regular price Sale price $982.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:others

Uniprot ID:Q9XSW8

Gene Names:CGA

Organism:Canis familiaris (Dog) (Canis lupus familiaris)

AA Sequence:FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS

Expression Region:25-120aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:18.1 kDa

Alternative Name(s):Anterior pituitary glycoprotein hormones common subunit alpha;Follicle-stimulating hormone alpha chain;FSH-alpha;Follitropin alpha chain;Luteinizing hormone alpha chain;LSH-alpha;Lutropin alpha chain;Thyroid-stimulating hormone alpha chain;TSH-alpha;Thyrotropin alpha chain

Relevance:Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.

Reference:"cDNA cloning of canine common alpha gene and its co-expression with canine thyrotropin beta gene in baculovirus expression system." Yang X., McGraw R.A., Ferguson D.C. Domest. Anim. Endocrinol. 18:379-393(2000)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details