Recombinant Didelphis marsupialis virginiana ATP synthase protein 8(MT-ATP8)

SKU: CSB-CF015071DKL

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Didelphis marsupialis virginiana (North American opossum)

Uniprot NO.:P41314

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPQLNTSTWTLTISLMIISLFCIYQLKMMNQTLIQITPSTEQSKLTKHTLPWEKKWTKIYLPHSSHQQF

Protein Names:Recommended name: ATP synthase protein 8 Alternative name(s): A6L F-ATPase subunit 8

Gene Names:Name:MT-ATP8 Synonyms:ATP8, ATPASE8, MTATP8

Expression Region:1-69

Sequence Info:full length protein