Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum UPF0041 protein A(DDB_G0267508)

Recombinant Dictyostelium discoideum UPF0041 protein A(DDB_G0267508)

SKU:CSB-CF687913DKK

Regular price $1,678.00 USD
Regular price Sale price $1,678.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q55GU4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAERWTKMVGFLGAAANWTIPIASFMNLKNDPEKVDPIMTTTLAVYSAVFMRWAIAIYPP NYWLLGCHVANEVAQLTQLGRYGKWKVFDSKQESDKQ

Protein Names:Recommended name: UPF0041 protein A

Gene Names:ORF Names:DDB_G0267508

Expression Region:1-97

Sequence Info:full length protein

View full details