Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0285135(DDB_G0285135)

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0285135(DDB_G0285135)

SKU:CSB-CF681677DKK

Regular price $1,828.00 USD
Regular price Sale price $1,828.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54NM7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIINNQNSPQSINTPSSVSSRQHINKSKKKKENVIKRMLIRLSNSNNRSLATVFGVIGGL VLGIVLVCKEYENFPLVGKGLPLVYRIVGIFLSAGTGGNLSSYIGGTIDIITGDKTVVDL YKSFKRYFKKVKDKNHRSPIPLTNLNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN SGGSGSTDNNNNNNEPIFSNNNSNNNNDNNSDLEIPIPI

Protein Names:Recommended name: Putative uncharacterized protein DDB_G0285135

Gene Names:ORF Names:DDB_G0285135

Expression Region:1-219

Sequence Info:full length protein

View full details