Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Protein transport protein got1 homolog(golt1)

Recombinant Dictyostelium discoideum Protein transport protein got1 homolog(golt1)

SKU:CSB-CF709644DKK

Regular price $1,729.00 USD
Regular price Sale price $1,729.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54CL4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFTDQQKIGAMLSAMGLFFGFLGVLLFLDRNLLALGNLLLVSGIVLILGLQKTTKFFAQK KKIKGTILFFFGIVVLLVTRWTFVGMVIEIFGFVNLFGDAFPIVISILRKLPIIGNILNH PLVNRLLQKADSGNELPF

Protein Names:Recommended name: Protein transport protein got1 homolog Alternative name(s): Golgi transport protein 1

Gene Names:Name:golt1 ORF Names:DDB_G0292868

Expression Region:1-138

Sequence Info:full length protein

View full details