Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Protein RER1 homolog(rer1)

Recombinant Dictyostelium discoideum Protein RER1 homolog(rer1)

SKU:CSB-CF684519DKK

Regular price $1,790.00 USD
Regular price Sale price $1,790.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54D10

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPTTIDEGLPAPHNFVSFTTLIARKYQNLIEKTISFIPQRWAFVGFLSFLYILRVSLSSG GWYVITYALGIFLLTRFIAFLSPKWDPELEEDSGDSLPTTLNRNDDEAKPFIRRLPEFLF WHSIFKALFISIFCTFIPFLDLPVFWPILLLYFIIIFSVTMKKQIKHMIKYKYIPFTVGK KTYTKNNS

Protein Names:Recommended name: Protein RER1 homolog

Gene Names:Name:rer1 ORF Names:DDB_G0292588

Expression Region:1-188

Sequence Info:full length protein

View full details