Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein S(mcfS)

Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein S(mcfS)

SKU:CSB-CF703689DKK

Regular price $1,908.00 USD
Regular price Sale price $1,908.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54FE6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTERGLKDSIAGTVAGAACLFTGHPFDTIRVRLQTSNTPIGIMECFRNTIKYEGFSGLY KGVTSPLFGMMFETAVLFAGYGQMKVLLQKDENTPLTVGQCAIAGGFAGVGASVVLTPVE LVKCRLQVQTTGPQKYKGSLDCLVQILKEGGIRGAYRGFTPTIAREFVGNMAFFSTYETC KRYFKNKENKPNDDDELNLPALIISGGLGGMAYWTVLYPVDVAKSKIQISEGAGPSPSIV KVLKEIYSKEGVKGLFRGYTPTIIRSFPANAAMFSVYELVIKLLG

Protein Names:Recommended name: Mitochondrial substrate carrier family protein S Alternative name(s): Carnitine/acylcarnitine translocase Short name= CAC Solute carrier family 25 member 20 homolog B

Gene Names:Name:mcfS Synonyms:slc25a20B ORF Names:DDB_G0290913

Expression Region:1-285

Sequence Info:full length protein

View full details