Gene Bio Systems
Recombinant Dictyostelium discoideum Dolichol phosphate-mannose biosynthesis regulatory protein(dpm2-1)
Recombinant Dictyostelium discoideum Dolichol phosphate-mannose biosynthesis regulatory protein(dpm2-1)
SKU:CSB-CF700985DKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:Q556K9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGASDKFIGFVMVLFRIFVFGYYTTWVIITPFIVSDHWIQQYFLPREYGIIIPLVLLVVG ITAIGTFLGLVMIKSKKNK
Protein Names:Recommended name: Dolichol phosphate-mannose biosynthesis regulatory protein
Gene Names:Name:dpm2-1 ORF Names:DDB_G0272588 ANDName: dpm2-2ORF Names: DDB_G0273981
Expression Region:1-79
Sequence Info:full length protein
