Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulfococcus oleovorans UPF0059 membrane protein Dole_1531 (Dole_1531)

Recombinant Desulfococcus oleovorans UPF0059 membrane protein Dole_1531 (Dole_1531)

SKU:CSB-CF427341DHW

Regular price $1,859.00 USD
Regular price Sale price $1,859.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Desulfococcus oleovorans (strain DSM 6200 / Hxd3)

Uniprot NO.:A8ZZT5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNTLTIFGIAVALAMDAFAVSIAAGVFLRSIGLRHYFRLAWHFGLFQALMPIVGWYAGLS VRGLIERYDHWIAFFLLAFVSFNMIRESFDAGENHTKADPTRGLRLVLLSIATSIDALAV GLSLSVLNVSVWMPATVIGITAAVFTVGGLMMGSRAGDIPWLRRYADRVGAGVLLFIGLR ILYAHGVFY

Protein Names:Recommended name: UPF0059 membrane protein Dole_1531

Gene Names:Ordered Locus Names:Dole_1531

Expression Region:1-189

Sequence Info:full length protein

View full details