GeneBio Systems
Recombinant Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E
Recombinant Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E
SKU:P00984
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P00984
Gene Names: N/A
Alternative Name(s): (DTX-E)(Venom basic protease inhibitor E)
Abbreviation: Recombinant Dendroaspis polylepis polylepis DTX-E protein
Organism: Dendroaspis polylepis polylepis (Black mamba)
Source: Mammalian cell
Expression Region: 1-59aa
Protein Length: Full Length
Tag Info: C-terminal hFc1-tagged
Target Protein Sequence: LQHRTFCKLPAEPGPCKASIPAFYYNWAAKKCQLFHYGGCKGNANRFSTIEKCRHACVG
MW: 35.5 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Serine protease inhibitor that inhibits trypsin (Kd=1 nM) and chymotrypsin (Kd=100 nM). May also inhibit voltage-gated potassium channels (Kv). Binds transition metal ions such as copper and cobalt.
Reference: "Snake venoms. The amino-acid sequence of trypsin inhibitor E of Dendroaspis polylepis polylepis (black mamba) venom." Joubert F.J., Strydom D.J. Eur. J. Biochem. 87: 191-198(1978)
Function:
